PDB entry 1ru7

View 1ru7 on RCSB PDB site
Description: 1934 Human H1 Hemagglutinin
Class: Viral protein
Keywords: HEMAGGLUTININ, ENVELOPE PROTEIN, GLYCOPROTEIN, Viral protein
Deposited on 2003-12-11, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Puerto Rico/8/34(H1N1)) [TaxId:211044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru7l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ru7A (A:)
    adaddticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7A (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru7B (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ru7C (C:)
    adaddticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7C (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru7D (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ru7E (E:)
    adaddticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7E (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ru7F (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7F (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ru7G (G:)
    adaddticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7G (G:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru7H (H:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ru7I (I:)
    adaddticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7I (I:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru7J (J:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ru7K (K:)
    adaddticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcn
    iagwllgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfei
    fpkesswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlw
    gihhppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpg
    dtiifeangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihp
    vtigecpkyvrsaklrmvtglrnipar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7K (K:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
    llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
    sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
    ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
    feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
    ecpkyvrsaklrmvtglrnipar
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ru7L (L:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru7L (L:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcdnecmesvrngtydy