PDB entry 1ru5

View 1ru5 on RCSB PDB site
Description: Solution structure of porcine peptide YY (pPYY)
Class: hormone/growth factor
Keywords: alpha-helical, PP-fold, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-12-11, released 2004-06-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide YY
    Species: Sus scrofa [TaxId:9823]
    Gene: PYY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ru5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru5A (A:)
    ypakpeapgedaspeelsryyaslrhylnlvtrqry