PDB entry 1ru4

View 1ru4 on RCSB PDB site
Description: Crystal structure of pectate lyase Pel9A
Deposited on 2003-12-11, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.167
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ru4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru4A (A:)
    adcssdltsgistkriyyvapngnssnngssfnapmsfsaamaavnpgelillkpgtyti
    pytqgkgntitfnksgkdgapiyvaaancgravfdfsfpdsqwvqasygfyvtgdywyfk
    gvevtragyqgayvigshntfentafhhnrntgleinnggsyntvinsdayrnydpkkng
    smadgfgpkqkqgpgnrfvgcrawensddgfdlfdspqkvvienswafrnginywndsaf
    agngngfklggnqavgnhritrsvafgnvskgfdqnnnaggvtvinntsyknginygfgs
    nvqsgqkhyfrnnvslsasvtvsnadaksnswdtgpaasasdfvsldtslatvsrdndgt
    lpetslfrlsansklinagtkesnisysgsapdlgafern