PDB entry 1ru4

View 1ru4 on RCSB PDB site
Description: Crystal structure of pectate lyase Pel9A
Class: lyase
Keywords: Parallel beta-helix, LYASE
Deposited on 2003-12-11, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.167
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: PelL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ru4a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ru4A (A:)
    adcssdltsgistkriyyvapngnssnngssfnapmsfsaamaavnpgelillkpgtyti
    pytqgkgntitfnksgkdgapiyvaaancgravfdfsfpdsqwvqasygfyvtgdywyfk
    gvevtragyqgayvigshntfentafhhnrntgleinnggsyntvinsdayrnydpkkng
    smadgfgpkqkqgpgnrfvgcrawensddgfdlfdspqkvvienswafrnginywndsaf
    agngngfklggnqavgnhritrsvafgnvskgfdqnnnaggvtvinntsyknginygfgs
    nvqsgqkhyfrnnvslsasvtvsnadaksnswdtgpaasasdfvsldtslatvsrdndgt
    lpetslfrlsansklinagtkesnisysgsapdlgafern