PDB entry 1ru0

View 1ru0 on RCSB PDB site
Description: Crystal structure of DCoH2, a paralog of DCoH, the Dimerization Cofactor of HNF-1
Class: lyase
Keywords: alpha and beta structure, LYASE
Deposited on 2003-12-10, released 2004-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DcoH-like protein DCoHm
    Species: Mus musculus [TaxId:10090]
    Gene: DCOHM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru0a_
  • Chain 'B':
    Compound: DcoH-like protein DCoHm
    Species: Mus musculus [TaxId:10090]
    Gene: DCOHM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ru0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ru0A (A:)
    gsmssdaqwltaeerdqlipglkaagwselserdaiykefsfknfnqafgfmsrvalqae
    kmnhhpewfnvynkvqitltshdcggltkrdvklaqfiekaaasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru0A (A:)
    daqwltaeerdqlipglkaagwselserdaiykefsfknfnqafgfmsrvalqaekmnhh
    pewfnvynkvqitltshdcggltkrdvklaqfiekaaasl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ru0B (B:)
    gsmssdaqwltaeerdqlipglkaagwselserdaiykefsfknfnqafgfmsrvalqae
    kmnhhpewfnvynkvqitltshdcggltkrdvklaqfiekaaasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ru0B (B:)
    daqwltaeerdqlipglkaagwselserdaiykefsfknfnqafgfmsrvalqaekmnhh
    pewfnvynkvqitltshdcggltkrdvklaqfiekaaa