PDB entry 1rty

View 1rty on RCSB PDB site
Description: Crystal Structure of Bacillus subtilis YvqK, a putative ATP-binding Cobalamin Adenosyltransferase, The North East Structural Genomics Target SR128
Deposited on 2003-12-10, released 2003-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rtya_
  • Chain 'B':
    Domains in SCOP 1.69: d1rtyb_
  • Chain 'C':
    Domains in SCOP 1.69: d1rtyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rtyA (A:)
    mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltael
    ltiqhelfdcggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcas
    llhiartitrraerrvvalmkseeihetvlrylnrlsdyffagarvvnarsgigdveyer
    saivfrdrnsses
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtyA (A:)
    kdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaivtdyk
    lteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvvalmksee
    ihetvlrylnrlsdyffagarvvnarsgigdveyersa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rtyB (B:)
    mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltael
    ltiqhelfdcggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcas
    llhiartitrraerrvvalmkseeihetvlrylnrlsdyffagarvvnarsgigdveyer
    saivfrdrnsses
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtyB (B:)
    mklytdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaiv
    terkdyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvv
    almkseeihetvlrylnrlsdyffagarvvnarsgigdveyer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rtyC (C:)
    mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltael
    ltiqhelfdcggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcas
    llhiartitrraerrvvalmkseeihetvlrylnrlsdyffagarvvnarsgigdveyer
    saivfrdrnsses
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtyC (C:)
    kdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaykltee
    svsfletridaytaeapelkkfilpggskcasllhiartitrraerrvvalmkseeihet
    vlrylnrlsdyffagarvvnarsgigdveyersaivfrdrns