PDB entry 1rtx

View 1rtx on RCSB PDB site
Description: Crystal Structure of Synechocystis Hemoglobin with a Covalent Heme Linkage
Deposited on 2003-12-10, released 2004-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rtxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtxA (A:)
    stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
    dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
    lnq