PDB entry 1rtw

View 1rtw on RCSB PDB site
Description: X-ray Structure of PF1337, a TenA Homologue from Pyrococcus furiosus. Northeast Structural Genomics Research Consortium (Nesg) Target PFR34
Class: structural genomics, unknown function
Keywords: pf1337, tena, thiamin, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function
Deposited on 2003-12-10, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.24
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional activator, putative
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U189 (0-End)
      • modified residue (0)
      • modified residue (25)
      • modified residue (53)
      • modified residue (57)
      • modified residue (81)
    Domains in SCOPe 2.07: d1rtwa_
  • Chain 'B':
    Compound: transcriptional activator, putative
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U189 (0-End)
      • modified residue (0)
      • modified residue (25)
      • modified residue (53)
      • modified residue (57)
      • modified residue (81)
    Domains in SCOPe 2.07: d1rtwb_
  • Chain 'C':
    Compound: transcriptional activator, putative
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U189 (0-End)
      • modified residue (0)
      • modified residue (25)
      • modified residue (53)
      • modified residue (57)
      • modified residue (81)
    Domains in SCOPe 2.07: d1rtwc_
  • Chain 'D':
    Compound: transcriptional activator, putative
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U189 (0-End)
      • modified residue (0)
      • modified residue (25)
      • modified residue (53)
      • modified residue (57)
      • modified residue (81)
    Domains in SCOPe 2.07: d1rtwd_
  • Heterogens: PO4, MP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rtwA (A:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiayggegnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtwA (A:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rtwB (B:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiayggegnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtwB (B:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiaygge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rtwC (C:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiayggegnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtwC (C:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiaygg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rtwD (D:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiayggegnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtwD (D:)
    mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
    apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
    gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
    efekerarevfkevskfelifwdiay