PDB entry 1rtu

View 1rtu on RCSB PDB site
Description: ustilago sphaerogena ribonuclease u2
Deposited on 1995-05-12, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.143
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rtu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1rtu_ (-)
    cdipqstncggnvysnddintaiqgalddvangdrpdnyphqyyxeaseditlccgsgpw
    sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtu_ (-)
    cdipqstncggnvysnddintaiqgalddvangdrpdnyphqyyeaseditlccgsgpws
    efplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs