PDB entry 1rtt

View 1rtt on RCSB PDB site
Description: Crystal structure determination of a putative NADH-dependent reductase using sulfur anomalous signal
Class: Structural genomics, unknown function
Keywords: Protein Structure Initiative, SAD with sulfur, putative reductase, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, Structural genomics, unknown function
Deposited on 2003-12-10, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.211
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rtta_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rttA (A:)
    mslsddikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfp
    paverfreqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagr
    fgtaraqyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql
    wvreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rttA (A:)
    ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf
    reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara
    qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql