PDB entry 1rtr

View 1rtr on RCSB PDB site
Description: Crystal Structure of S. Aureus Farnesyl Pyrophosphate Synthase
Class: transferase
Keywords: transferase
Deposited on 2003-12-10, released 2004-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NWD6
      • conflict (197)
    Domains in SCOPe 2.04: d1rtra_
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NWD6
      • conflict (197)
    Domains in SCOPe 2.04: d1rtrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rtrA (A:)
    mtnlpmnklidevnnelsvainksvmdtqleesmlyslnaggkrirpvlllltldslnte
    yelgmksaialemihtyslihddlpamdnddyrrgkltnhkvygewtailagdalltkaf
    elissddrltdevkikvlqrlsiasghvgmvggqmldmqsegqpidletlemihktktga
    lltfavmsaadianvddttkehlesysyhlgmmfqikddlldcygdeaklgkkvgsdlen
    nkstyvsllgkdgaedkltyhrdaavdeltqideqfntkhlleivdlfysrdhkghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtrA (A:)
    tnlpmnklidevnnelsvainksvmdtqleesmlyslnaggkrirpvlllltldslntey
    elgmksaialemihtyslihddlpamdnddyrrgkltnhkvygewtailagdalltkafe
    lissddrltdevkikvlqrlsiasghvgmvggqmldmqsegqpidletlemihktktgal
    ltfavmsaadianvddttkehlesysyhlgmmfqikddlldcygdeakstyvsllgkdga
    edkltyhrdaavdeltqideqfntkhlleivdlfysr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rtrB (B:)
    mtnlpmnklidevnnelsvainksvmdtqleesmlyslnaggkrirpvlllltldslnte
    yelgmksaialemihtyslihddlpamdnddyrrgkltnhkvygewtailagdalltkaf
    elissddrltdevkikvlqrlsiasghvgmvggqmldmqsegqpidletlemihktktga
    lltfavmsaadianvddttkehlesysyhlgmmfqikddlldcygdeaklgkkvgsdlen
    nkstyvsllgkdgaedkltyhrdaavdeltqideqfntkhlleivdlfysrdhkghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtrB (B:)
    tnlpmnklidevnnelsvainksvmdtqleesmlyslnaggkrirpvlllltldslntey
    elgmksaialemihtyslihddlpamdnddyrrgkltnhkvygewtailagdalltkafe
    lissddrltdevkikvlqrlsiasghvgmvggqmldmqsegqpidletlemihktktgal
    ltfavmsaadianvddttkehlesysyhlgmmfqikddlldcstyvsllgkdgaedklty
    hrdaavdeltqideqfntkhlleivdlfysr