PDB entry 1rtp

View 1rtp on RCSB PDB site
Description: refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-05-14, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: alpha-parvalbumin
    Species: RATTUS RATTUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rtp1_
  • Chain '2':
    Compound: alpha-parvalbumin
    Species: RATTUS RATTUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rtp2_
  • Chain '3':
    Compound: alpha-parvalbumin
    Species: RATTUS RATTUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rtp3_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtp1 (1:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtp2 (2:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtp3 (3:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes