PDB entry 1rto

View 1rto on RCSB PDB site
Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
Deposited on 1995-02-21, released 1995-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rtoa_
  • Chain 'B':
    Domains in SCOP 1.71: d1rtob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtoA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtoB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems