PDB entry 1rtn

View 1rtn on RCSB PDB site
Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
Class: chemokine
Keywords: chemotactic cytokine, chemokine
Deposited on 1995-02-21, released 1995-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rantes
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13501 (0-67)
  Domains in SCOPe 2.06: d1rtna_
• Chain 'B':
  Compound: rantes
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13501 (0-67)
  Domains in SCOPe 2.06: d1rtnb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rtnA (A:)
  spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
  yinslems
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rtnB (B:)
  spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
  yinslems