PDB entry 1rtn

View 1rtn on RCSB PDB site
Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
Deposited on 1995-02-21, released 1995-06-03
The last revision prior to the SCOP 1.55 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1rtna_
  • Chain 'B':
    Domains in SCOP 1.55: d1rtnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtnA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtnB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems