PDB entry 1rtl

View 1rtl on RCSB PDB site
Description: crystal structure of hcv ns3 protease domain: ns4a peptide complex with covalently bound pyrrolidine-5,5-translactam inhibitor
Class: Viral protein complex
Keywords: VIRAL PROTEIN, SERINE PROTEASE, NONSTRUCTURAL PROTEIN, COFACTOR PEPTIDE, HELICASE, INHIBITOR, TRANSLACTAM, Viral protein complex
Deposited on 2003-12-10, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.182
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease/helicase
    Species: Hepatitis C virus [TaxId:11103]
    Gene: H STRAIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91RS4 (11-End)
      • engineered (174)
    Domains in SCOPe 2.07: d1rtl.1
  • Chain 'B':
    Compound: NS3 protease/helicase
    Species: Hepatitis C virus [TaxId:11103]
    Gene: H STRAIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91RS4
      • engineered (174)
    Domains in SCOPe 2.07: d1rtl.2
  • Chain 'C':
    Compound: ns4a cofactor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB CAB53095 (2-20)
      • cloning artifact (1)
      • cloning artifact (21)
    Domains in SCOPe 2.07: d1rtl.1
  • Chain 'D':
    Compound: ns4a cofactor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB CAB53095 (2-End)
    Domains in SCOPe 2.07: d1rtl.2
  • Heterogens: ZN, CPX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rtlA (A:)
    masmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcin
    gvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtr
    hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdf
    ipvenlettmrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtlA (A:)
    apitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgag
    trtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfipvenlettmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rtlB (B:)
    masmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcin
    gvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtr
    hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdf
    ipvenlettmrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtlB (B:)
    qvegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpa
    pqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpa
    ghavglfraavctrgvtkavdfipvenlettmr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rtlC (C:)
    kkgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtlC (C:)
    kgsvvivgrivlsgkpaiipk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rtlD (D:)
    kkgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtlD (D:)
    gsvvivgrivlsgkpa