PDB entry 1rte

View 1rte on RCSB PDB site
Description: X-ray Structure of Cyanide Derivative of Truncated Hemoglobin N (trHbN) from Mycobacterium Tuberculosis
Deposited on 2003-12-10, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rtea_
  • Chain 'B':
    Domains in SCOP 1.69: d1rteb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rteA (A:)
    mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rteA (A:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvtsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rteB (B:)
    mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqve
    ffaaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgvia
    plavdvtsgesttapv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rteB (B:)
    gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
    faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
    lavdvtsg