PDB entry 1rtd

View 1rtd on RCSB PDB site
Description:
Deposited on 1998-08-26, released 1998-12-09
The last revision prior to the SCOP 1.65 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.224
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rtda1, d1rtda2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rtdb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rtdc1, d1rtdc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1rtdd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtdA (A:)
    kispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndicklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltdttnqktqlq
    aiylalqdsglevnivtdsqyalgiiqaqpdeseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rtdB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtdB (B:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
    dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvn
    diqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvh
    gvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqki
    ttesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtdC (C:)
    kispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndicklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltdttnqktqlq
    aiylalqdsglevnivtdsqyalgiiqaqpdeseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rtdD (D:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rtdD (D:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
    dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvn
    diqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvh
    gvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqki
    ttesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql