PDB entry 1rta

View 1rta on RCSB PDB site
Description: crystal structure disposition of thymidylic acid tetramer in complex with ribonuclease a
Class: hydrolase/DNA
Keywords: protein-DNA complex, hydrolase/DNA complex
Deposited on 1992-08-28, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*tp*t)-3')
  • Chain 'E':
    Compound: protein (ribonuclease a (e.c.3.1.27.5))
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rtae_

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rtaE (E:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv