PDB entry 1rt3

View 1rt3 on RCSB PDB site
Description: azt drug resistant hiv-1 reverse transcriptase complexed with 1051u91
Deposited on 1998-06-29, released 1999-02-16
The last revision prior to the SCOP 1.71 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.264
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rt3A (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkknstrwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglftpdqkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rt3A (A:)
    ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
    aikkknstrwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
    edfrkytaftipsipgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymd
    dlyvgsdleigqhrtkieelrqhllrwglftpdqkhqkeppflwmgyelhpdkwtvqpiv
    lpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelae
    nreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndv
    kqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvkl
    wyqlekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevniv
    tdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rt3B (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkknstrwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rt3B (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kknstrwrklvdfrelnkrtqdfiphpaglkkkksvtvldvgdayfsvpldedfrkytaf
    tipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvg
    sdleigqhrtkieelrqhllrwglgyelhpdkwtvqpivlpekdswtvndiqklvgklnw
    asqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdli
    aeiqkqgqgqwtyqiyqepfknlktgkyarmtndvkqlteavqkittesiviwgktpkfk
    lpiqketwetwwteywqatwipewefvntpplvklwyq