PDB entry 1rst

View 1rst on RCSB PDB site
Description: complex between streptavidin and the strep-tag peptide
Deposited on 1995-10-19, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.55: d1rstb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rstB (B:)
meagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp