PDB entry 1rss

View 1rss on RCSB PDB site
Description: ribosomal protein s7 from thermus thermophilus
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding, translation
Deposited on 1997-08-05, released 1998-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s7
    Species: Thermus thermophilus [TaxId:274]
    Gene: S7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rssa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rssA (A:)
    maevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqa
    venvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelm
    daaegkggavkkkedvermaeanrayahyrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rssA (A:)
    lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
    rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
    ggavkkkedvermaeahyrw