PDB entry 1rso

View 1rso on RCSB PDB site
Description: hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Deposited on 2003-12-09, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rsoa_
  • Chain 'B':
    Domains in SCOP 1.67: d1rsob_
  • Chain 'C':
    Domains in SCOP 1.67: d1rsoc_
  • Chain 'D':
    Domains in SCOP 1.67: d1rsod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoA (A:)
    rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoB (B:)
    gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoC (C:)
    rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoD (D:)
    gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks