PDB entry 1rso
View 1rso on RCSB PDB site
Description: Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of supra-molecular assemblies
Class: neuropeptide/membrane protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity, NEUROPEPTIDE/MEMBRANE PROTEIN COMPLEX
Deposited on
2003-12-09, released
2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Presynaptic protein SAP97
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1rsoa_ - Chain 'B':
Compound: Peripheral plasma membrane protein CASK
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1rsob_ - Chain 'C':
Compound: Presynaptic protein SAP97
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1rsoc_ - Chain 'D':
Compound: Peripheral plasma membrane protein CASK
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1rsod_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1rsoA (A:)
rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1rsoB (B:)
gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1rsoC (C:)
rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1rsoD (D:)
gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks