PDB entry 1rso

View 1rso on RCSB PDB site
Description: Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of supra-molecular assemblies
Class: neuropeptide/membrane protein
Keywords: L27 domain, scaffold protein, protein assembly, cell polarity, NEUROPEPTIDE/MEMBRANE PROTEIN COMPLEX
Deposited on 2003-12-09, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Presynaptic protein SAP97
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rsoa_
  • Chain 'B':
    Compound: Peripheral plasma membrane protein CASK
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62915 (0-55)
      • engineered (24)
    Domains in SCOPe 2.08: d1rsob_
  • Chain 'C':
    Compound: Presynaptic protein SAP97
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rsoc_
  • Chain 'D':
    Compound: Peripheral plasma membrane protein CASK
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62915 (0-55)
      • engineered (24)
    Domains in SCOPe 2.08: d1rsod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoA (A:)
    rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoB (B:)
    gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoC (C:)
    rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsoD (D:)
    gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks