PDB entry 1rsn
View 1rsn on RCSB PDB site
Description: ribonuclease (RNAse sa) (e.c.3.1.4.8) complexed with exo-2',3'-cyclophosphorothioate
Class: hydrolase (guanyloribonuclease)
Keywords: hydrolase (guanyloribonuclease)
Deposited on
1995-09-01, released
1995-12-07
The last revision prior to the SCOP 1.75 freeze date was dated
1995-12-07, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.119
AEROSPACI score: 0.64
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease sa
Species: Streptomyces aureofaciens
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1rsna_ - Chain 'B':
Compound: ribonuclease sa
Species: Streptomyces aureofaciens
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1rsnb_ - Heterogens: SO4, SGP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1rsnA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1rsnB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc