PDB entry 1rsn

View 1rsn on RCSB PDB site
Description: ribonuclease (RNAse sa) (e.c.3.1.4.8) complexed with exo-2',3'-cyclophosphorothioate
Class: hydrolase (guanyloribonuclease)
Keywords: hydrolase (guanyloribonuclease)
Deposited on 1995-09-01, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.119
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rsna_
  • Chain 'B':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rsnb_
  • Heterogens: SO4, SGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsnA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriicgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rsnB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriicgeatqedyytgdhyatfslidqtc