PDB entry 1rsm

View 1rsm on RCSB PDB site
Description: the 2-angstroms resolution structure of a thermostable ribonuclease a chemically cross-linked between lysine residues 7 and 41
Class: hydrolase (nucleic acid,RNA)
Keywords: hydrolase (nucleic acid,RNA)
Deposited on 1985-08-27, released 1986-01-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.05: d1rsma_
• Heterogens: NIN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rsmA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv