PDB entry 1rsm

View 1rsm on RCSB PDB site
Description: the 2-angstroms resolution structure of a thermostable ribonuclease a chemically cross-linked between lysine residues 7 and 41
Deposited on 1985-08-27, released 1986-01-21
The last revision prior to the SCOP 1.57 freeze date was dated 1989-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1rsm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rsm_ (-)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv