PDB entry 1rsf

View 1rsf on RCSB PDB site
Description: NMR Structure of Monomeric CAR d1 domain
Class: signaling protein
Keywords: CAR, NMR, Coxsackievirus, Adenovirus, SIGNALING PROTEIN
Deposited on 2003-12-09, released 2004-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: coxsackievirus and adenovirus receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: CXADR, CAR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78310 (2-125)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1rsfa1, d1rsfa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rsfA (A:)
  gssittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
  iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl
  vkpsga