PDB entry 1rsd

View 1rsd on RCSB PDB site
Description: DHNA complex with 3-(5-Amino-7-hydroxy-[1,2,3]triazolo[4,5-d]pyrimidin-2-yl)-N-[2-(2-hydroxymethyl-phenylsulfanyl)-benzyl]-benzamide
Class: lyase
Keywords: DHNA, 7,8-Dihydroneopterin Aldolase, 3-(5-Amino-7-hydroxy-[1,2,3]triazolo[4,5-d]pyrimidin-2-yl)-N-[2-(2-hydroxymethyl-phenylsulfanyl)-benzyl]-benzamide, LYASE
Deposited on 2003-12-09, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.28
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroneopterin aldolase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rsda_
  • Heterogens: PSB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rsdA (A:)
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k