PDB entry 1rsc

View 1rsc on RCSB PDB site
Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
Class: lyase (carbon-carbon)
Keywords: lyase (carbon-carbon)
Deposited on 1994-03-29, released 1995-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.255
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rsca1, d1rsca2
  • Chain 'B':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rscb1, d1rscb2
  • Chain 'C':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rscc1, d1rscc2
  • Chain 'D':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rscd1, d1rscd2
  • Chain 'E':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rsce1, d1rsce2
  • Chain 'F':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rscf1, d1rscf2
  • Chain 'G':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rscg1, d1rscg2
  • Chain 'H':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rsch1, d1rsch2
  • Chain 'I':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rsci_
  • Chain 'J':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rscj_
  • Chain 'K':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rsck_
  • Chain 'L':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rscl_
  • Chain 'M':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rscm_
  • Chain 'N':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rscn_
  • Chain 'O':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rsco_
  • Chain 'P':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Synechococcus sp.
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (1-End)
      • conflict (96)
    Domains in SCOP 1.75: d1rscp_
  • Heterogens: XBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rscA (A:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscA (A:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rscB (B:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscB (B:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rscC (C:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscC (C:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rscD (D:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscD (D:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rscE (E:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscE (E:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rscF (F:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscF (F:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rscG (G:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscG (G:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rscH (H:)
    mpktqsaagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesst
    gtwttvwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgn
    vfgfkairslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsak
    nygravyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvt
    aptceemmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidr
    qrnhgihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvf
    ftqdwasmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrva
    leacvqarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscH (H:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rscI (I:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscI (I:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rscJ (J:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscJ (J:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rscK (K:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscK (K:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rscL (L:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscL (L:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1rscM (M:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscM (M:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1rscN (N:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscN (N:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1rscO (O:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscO (O:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1rscP (P:)
    msmktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwkl
    plfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rscP (P:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr