PDB entry 1rs4

View 1rs4 on RCSB PDB site
Description: DHNA, 7,8-Dihydroneopterin Aldolase complexed with 3-(5-Amino-7-hydroxy-[1,2,3]triazolo[4,5-d]pyrimidin-2-yl)-N-(3,5-dichlorobenzyl)-benzamide
Deposited on 2003-12-09, released 2004-03-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.263
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1rs4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rs4A (A:)
  mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
  vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
  k