PDB entry 1rs2

View 1rs2 on RCSB PDB site
Description: DHNA complex with 8-Amino-1,3-dimethyl-3,7-dihydropurine-2,6-dione
Class: lyase
Keywords: DHNA, 7,8-Dihydroneop8-Amino-1,3-dimethyl-3,7-dihydropurine-2,6-dioneterin Aldolase, LYASE
Deposited on 2003-12-09, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.265
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroneopterin aldolase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rs2a_
  • Heterogens: 209, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rs2A (A:)
    mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
    vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
    k