PDB entry 1rs2

View 1rs2 on RCSB PDB site
Description: DHNA complex with 8-Amino-1,3-dimethyl-3,7-dihydropurine-2,6-dione
Deposited on 2003-12-09, released 2004-03-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.265
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rs2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rs2A (A:)
    mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
    vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
    k