PDB entry 1rs0

View 1rs0 on RCSB PDB site
Description: Crystal Structure Analysis of the Bb segment of Factor B complexed with Di-isopropyl-phosphate (DIP)
Class: hydrolase
Keywords: factor B, Bb, factor Bb-DIP complex, HYDROLASE
Deposited on 2003-12-09, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor b
    Species: Homo sapiens [TaxId:9606]
    Gene: BF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00751 (0-496)
      • engineered (24)
      • engineered (185)
      • engineered (192)
    Domains in SCOPe 2.07: d1rs0a1, d1rs0a2
  • Heterogens: IOD, NA, MG, DFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rs0A (A:)
    smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
    dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
    tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
    neqhvckvkdmecledvfyqmidesqslslcgmvwehrkgtdyhkqpwqakisvirpskg
    hescmgavvseyfvltaahcftvddkehsikvsvggekrdleievvlfhpnyningkkea
    gipefydydvaliklknklkygqtirpiclpctegttralrlpptttcqqqkeellpaqd
    ikalfvseeekkltrkevyikngdkkgscerdaqyapgydkvkdisevvtprflctggvs
    pyadpntcrgdsggplivhkrsrfiqvgviswgvvdvcknqkrqkqvpahardfhinlfq
    vlpwlkeklqdedlgfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rs0A (A:)
    smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
    dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpgwnrtrhviilmtdglhn
    mggdpitvideirdllyigkdrnpredyldvyvfgvgplvnqvninalaskkdneqhvck
    vkdmecledvfyqmidesqslslcgmvwehrkgtdyhkqpwqakisvirkghescmgavv
    seyfvltaahcftvddkehsikvsvggekrdleievvlfhpnyningkkeagipefydyd
    valiklknklkygqtirpiclpctegttralrlpptttcqqqkeellpaqdikalfvsee
    ekkltrkevyikngdkkgscerdaqyapgydkvkdisevvtprflctggvspyadpntcr
    gdsggplivhkrsrfiqvgviswgvvdvcvpahardfhinlfqvlpwlkeklqdedlgfl