PDB entry 1rrz

View 1rrz on RCSB PDB site
Description: solution structure of glgs protein from e. coli
Deposited on 2003-12-09, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rrza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rrzA (A:)
mgsshhhhhhssglvprgshmdhslnslnnfdflarsfarmhaegrpvdilavtgnmdee
hrtwfcaryawycqqmmqareleleh

    Sequence, based on observed residues (ATOM records): (download) 
    >1rrzA (A:)
mdhslnslnnfdflarsfarmhaegrpvdilavtgnmdeehrtwfcaryawycqqmmqar
eleleh