PDB entry 1rrz

View 1rrz on RCSB PDB site
Description: Solution structure of GlgS protein from E. coli
Class: structural genomics,biosynthetic protein
Keywords: all-helical domain, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, STRUCTURAL GENOMICS,BIOSYNTHETIC PROTEIN
Deposited on 2003-12-09, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthesis protein glgS
    Species: Escherichia coli [TaxId:562]
    Gene: GLGS, B3049
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rrza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rrzA (A:)
mgsshhhhhhssglvprgshmdhslnslnnfdflarsfarmhaegrpvdilavtgnmdee
hrtwfcaryawycqqmmqareleleh

    Sequence, based on observed residues (ATOM records): (download) 
    >1rrzA (A:)
mdhslnslnnfdflarsfarmhaegrpvdilavtgnmdeehrtwfcaryawycqqmmqar
eleleh