PDB entry 1rry

View 1rry on RCSB PDB site
Description: DHNA complexed with 2-amino-4-hydroxy-5-carboxyethylpyrimidine
Deposited on 2003-12-09, released 2004-03-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rrya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rryA (A:)
    mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
    vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
    k