PDB entry 1rrx

View 1rrx on RCSB PDB site
Description: Crystallographic Evidence for Isomeric Chromophores in 3-Fluorotyrosyl-Green Fluorescent Protein
Class: luminescent protein
Keywords: Beta-barrel, EGFP, Non-canonical amino acid, chromophore isomerisation, LUMINESCENT PROTEIN
Deposited on 2003-12-09, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SIGF1-GFP fusion protein
  Species: Aequorea victoria [TaxId:6100]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42212 (0-225)
    • chromophore (64)
  Domains in SCOPe 2.08: d1rrxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rrxA (A:)
  skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
  ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
  rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
  yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi