PDB entry 1rrv

View 1rrv on RCSB PDB site
Description: X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin.
Class: transferase/antibiotic
Keywords: gt-b, glycosyltransferase, rossmann fold, glycopeptide, vacosamycin, antibiotic, transferase-antibiotic complex
Deposited on 2003-12-09, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyltransferase gtfd
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Gene: gtfD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AFC7 (0-End)
      • cloning artifact (194-196)
    • PDB 1RRV
    Domains in SCOPe 2.06: d1rrva_
  • Chain 'B':
    Compound: glycosyltransferase gtfd
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Gene: gtfD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AFC7 (0-End)
      • cloning artifact (194-196)
    • PDB 1RRV
    Domains in SCOPe 2.06: d1rrvb_
  • Chain 'C':
    Compound: desvancosaminyl vancomycin
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00681 (0-6)
  • Chain 'D':
    Compound: desvancosaminyl vancomycin
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00681 (0-6)
  • Heterogens: K, TYD, GOL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrvA (A:)
    mrvllsvcgtrgdveigvaladrlkalgvqtrmcappaaeerlaevgvphvpvglpqhmm
    lqegmpppppeeeqrlaamtvemqfdavpgaaegcaavvavgdlaaatgvrsvaeklglp
    ffysvpspvylasphlppaydepttpgvtdirvlweeraarfadrygptlnrrraeiglp
    pvedvfgyghgerpllaadpvlaplqpdvdavqtgawllsderplppeleaflaagsppv
    higfgsssgrgiadaakvaveairaqgrrvilsrgwtelvlpddrddcfaidevnfqalf
    rrvaavihhgsagtehvatragvpqlviprntdqpyfagrvaalgigvahdgptptfesl
    saalttvlapetraraeavagmvltdgaaaaadlvlaavgrekpavpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrvA (A:)
    mrvllsvcgtrgdveigvaladrlkalgvqtrmcappaaeerlaevgvphvpvglpqhmm
    lqegmpppppeeeqrlaamtvemqfdavpgaaegcaavvavgdlaaatgvrsvaeklglp
    ffysvpspvylasphlppaydepttpgvtdirvlweeraarfadrygptlnrrraeiglp
    pvedvfgyghgerpllaadpvlaplqpdvdavqtgawllsderplppeleaflaagsppv
    higfgsssgrgiadaakvaveairaqgrrvilsrgwtelvlpddrddcfaidevnfqalf
    rrvaavihhgsagtehvatragvpqlviprntdqpyfagrvaalgigvahdgptptfesl
    saalttvlapetraraeavagmvltdgaaaaadlvlaavgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rrvB (B:)
    mrvllsvcgtrgdveigvaladrlkalgvqtrmcappaaeerlaevgvphvpvglpqhmm
    lqegmpppppeeeqrlaamtvemqfdavpgaaegcaavvavgdlaaatgvrsvaeklglp
    ffysvpspvylasphlppaydepttpgvtdirvlweeraarfadrygptlnrrraeiglp
    pvedvfgyghgerpllaadpvlaplqpdvdavqtgawllsderplppeleaflaagsppv
    higfgsssgrgiadaakvaveairaqgrrvilsrgwtelvlpddrddcfaidevnfqalf
    rrvaavihhgsagtehvatragvpqlviprntdqpyfagrvaalgigvahdgptptfesl
    saalttvlapetraraeavagmvltdgaaaaadlvlaavgrekpavpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrvB (B:)
    mrvllsvcgtrgdveigvaladrlkalgvqtrmcappaaeerlaevgvphvpvglpqhmm
    lqegmpppppeeeqrlaamtvemqfdavpgaaegcaavvavgdlaaatgvrsvaeklglp
    ffysvpspvylasphlppaydepttpgvtdirvlweeraarfadrygptlnrrraeiglp
    pvedvfgyghgerpllaadpvlaplqpdvdavqtgawllsderplppeleaflaagsppv
    higfgsssgrgiadaakvaveairaqgrrvilsrgwtelvlpddrddcfaidevnfqalf
    rrvaavihhgsagtehvatragvpqlviprntdqpyfagrvaalgigvahdgptptfesl
    saalttvlapetraraeavagmvltdgaaaaadlvlaavg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.