PDB entry 1rrt

View 1rrt on RCSB PDB site
Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
Deposited on 2003-12-08, released 2004-02-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrtA (A:)
    gshmtreterfparefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipy
    feqfidrfptlealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdef
    srlkgvgpytvgavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivrei
    mayenpgafnealielgalvctprrpscllcpvqaycqafaegvaeelpvkmkktavkqv
    plavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglqvelt
    epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
    wasgvrppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrtA (A:)
    parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
    ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
    gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
    alielgalvctprrpscllcpvqaycqafaegvaeelpvkmkktavkqvplavavladde
    grvlirkrdstgllanlwefpscetddgkekleqmvglqveltepivsfehafshlvwql
    tvfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewas