PDB entry 1rrs

View 1rrs on RCSB PDB site
Description: MutY adenine glycosylase in complex with DNA containing an abasic site
Class: hydrolase/DNA
Keywords: DNA repair, DNA glycosylase, 8-oxoguanine, protein-DNA complex, HYDROLASE/DNA COMPLEX
Deposited on 2003-12-08, released 2004-02-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutY
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: mutY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rrsa1, d1rrsa2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*gp*ap*cp*(8og)p*tp*gp*gp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*gp*tp*cp*cp*ap*(hpd)p*gp*tp*cp*t)-3'
  • Heterogens: CA, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrsA (A:)
    gshmtreterfparefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipy
    feqfidrfptlealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdef
    srlkgvgpytvgavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivrei
    mayenpgafnealielgalvctprrpscllcpvqaycqafaegvaeelpvkmkktavkqv
    plavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglqvelt
    epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
    wasgvrppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrsA (A:)
    parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
    ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
    gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
    alielgalvctprrpscllcpvqaycqafaegvaeelpvkmkvkqvplavavladdegrv
    lirkrdstgllanlwefpscetdgadgkekleqmvglqveltepivsfehafshlvwqlt
    vfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewas
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.