PDB entry 1rrp

View 1rrp on RCSB PDB site
Description: structure of the ran-gppnhp-ranbd1 complex
Class: complex (small gtpase/nuclear protein)
Keywords: complex (small gtpase/nuclear protein), small gtpase, nuclear transport
Deposited on 1999-01-15, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.252
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ran
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (0-203)
      • see remark 999 (121)
    Domains in SCOPe 2.07: d1rrpa_
  • Chain 'B':
    Compound: nuclear pore complex protein nup358
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rrpb_
  • Chain 'C':
    Compound: ran
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (0-End)
      • see remark 999 (121)
    Domains in SCOPe 2.07: d1rrpc_
  • Chain 'D':
    Compound: nuclear pore complex protein nup358
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rrpd_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rrpA (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rrpB (B:)
    hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
    rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
    aalfkckfeeaqsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rrpC (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrpC (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rrpD (D:)
    hfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsgki
    rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpee
    aalfkckfeeaqsi