PDB entry 1rrl

View 1rrl on RCSB PDB site
Description: Soybean Lipoxygenase (LOX-3) at 93K at 2.0 A resolution
Class: oxidoreductase
Keywords: oxidoreductase, iron metalloprotein, lipoxygenase
Deposited on 2003-12-08, released 2004-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09186 (Start-856)
      • see remark9 99 (24)
      • see remark 999 (56)
      • see remark 999 (111)
      • see remark 999 (200)
      • see remark 999 (381)
      • see remark 999 (427)
      • see remark 999 (629)
      • see remark 999 (24)
    Domains in SCOPe 2.06: d1rrla1, d1rrla2
  • Chain 'B':
    Compound: Seed lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09186 (Start-856)
      • see remark9 99 (24)
      • see remark 999 (56)
      • see remark 999 (111)
      • see remark 999 (200)
      • see remark 999 (381)
      • see remark 999 (427)
      • see remark 999 (629)
      • see remark 999 (24)
    Domains in SCOPe 2.06: d1rrlb1, d1rrlb2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrlA (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrlA (A:)
    rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk
    adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl
    vsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnl
    rgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdp
    nsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdev
    hglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefare
    mlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlfll
    dhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvfl
    padegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykll
    hphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikr
    gmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqac
    wkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrp
    tlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerd
    npnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskeglt
    frgipnsisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rrlB (B:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrlB (B:)
    rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk
    adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl
    vsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnl
    rgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdp
    nsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdev
    hglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefare
    mlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlfll
    dhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvfl
    padegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykll
    hphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikr
    gmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqac
    wkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrp
    tlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerd
    npnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskeglt
    frgipnsisi