PDB entry 1rrl

View 1rrl on RCSB PDB site
Description: soybean lipoxygenase (lox-3) at 93k at 2.0 a resolution
Deposited on 2003-12-08, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrlA (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrlA (A:)
    rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk
    adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl
    vsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnl
    rgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdp
    nsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdev
    hglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefare
    mlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlfll
    dhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvfl
    padegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykll
    hphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikr
    gmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqac
    wkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrp
    tlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerd
    npnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskeglt
    frgipnsisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rrlB (B:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrlB (B:)
    rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk
    adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl
    vsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnl
    rgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdp
    nsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdev
    hglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefare
    mlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlfll
    dhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvfl
    padegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykll
    hphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikr
    gmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqac
    wkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrp
    tlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerd
    npnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskeglt
    frgipnsisi