PDB entry 1rrj

View 1rrj on RCSB PDB site
Description: Structural Mechanisms of Camptothecin Resistance by Mutations in Human Topoisomerase I
Class: isomerase/DNA
Keywords: human topoisomerase I, topotecan, camptothecin, x-ray crystallography
Deposited on 2003-12-08, released 2004-07-06
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: HOMO SAPIENS
    Gene: TOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (0-564)
      • engineered (521)
      • modified residue (522)
    Domains in SCOP 1.73: d1rrja1, d1rrja2, d1rrja3
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*t*gp*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3'
  • Heterogens: TTG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rrjA (A:)
    qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
    akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
    keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
    diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekd
    wqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetad
    tvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqp
    eddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsyn
    ranravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdakt
    kkvveskkkavqrleeqlmklevqatdreenkqialgtsklsyldpritvawckkwgvpi
    ekiynktqrekfawaidmadedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.