PDB entry 1rrf

View 1rrf on RCSB PDB site
Description: non-myristoylated rat ADP-ribosylation factor-1 complexed with GDP, monomeric crystal form
Class: transport protein
Keywords: transport protein, GDP-binding, membrane trafficking
Deposited on 1995-12-16, released 1996-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rat ADP-ribosylation factor-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rrfa_
  • Heterogens: MG, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrfA (A:)
    mgnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykn
    isftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdav
    llvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrfA (A:)
    gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
    sftvwdvggqdkirplwrfqntqglifvvdsndrervneareelmrmlaedelrdavllv
    fankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr