PDB entry 1rre

View 1rre on RCSB PDB site
Description: Crystal structure of E.coli Lon proteolytic domain
Class: hydrolase
Keywords: ATP-dependent protease, catalytic Ser-Lys dyad
Deposited on 2003-12-08, released 2004-02-03
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease La
    Species: Escherichia coli
    Gene: LON, CAPR, DEG, MUC, LOPA, B0439, C0555
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M0
      • modified residue (49)
      • engineered (94)
      • modified residue (99)
      • modified residue (118)
    Domains in SCOP 1.73: d1rrea_
  • Chain 'B':
    Compound: ATP-dependent protease La
    Species: Escherichia coli
    Gene: LON, CAPR, DEG, MUC, LOPA, B0439, C0555
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M0
      • modified residue (49)
      • engineered (94)
      • modified residue (99)
      • modified residue (118)
    Domains in SCOP 1.73: d1rreb_
  • Chain 'C':
    Compound: ATP-dependent protease La
    Species: Escherichia coli
    Gene: LON, CAPR, DEG, MUC, LOPA, B0439, C0555
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M0
      • modified residue (49)
      • engineered (94)
      • modified residue (99)
      • modified residue (118)
    Domains in SCOP 1.73: d1rrec_
  • Chain 'D':
    Compound: ATP-dependent protease La
    Species: Escherichia coli
    Gene: LON, CAPR, DEG, MUC, LOPA, B0439, C0555
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M0
      • modified residue (49)
      • engineered (94)
      • modified residue (99)
      • modified residue (118)
    Domains in SCOP 1.73: d1rred_
  • Chain 'E':
    Compound: ATP-dependent protease La
    Species: Escherichia coli
    Gene: LON, CAPR, DEG, MUC, LOPA, B0439, C0555
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M0 (Start-199)
      • modified residue (49)
      • engineered (94)
      • modified residue (99)
      • modified residue (118)
      • modified residue (193)
    Domains in SCOP 1.73: d1rree_
  • Chain 'F':
    Compound: ATP-dependent protease La
    Species: Escherichia coli
    Gene: LON, CAPR, DEG, MUC, LOPA, B0439, C0555
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9M0
      • modified residue (49)
      • engineered (94)
      • modified residue (99)
      • modified residue (118)
    Domains in SCOP 1.73: d1rref_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rreA (A:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rreA (A:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rreB (B:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rreB (B:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rreC (C:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rreC (C:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rreD (D:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rreD (D:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    ep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rreE (E:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rreE (E:)
    rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
    inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
    lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
    epsgmqvvtak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rreF (F:)
    dygradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltv
    vraraeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamt
    geitlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrie
    evltlalqnepsgmqvvtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rreF (F:)
    nrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraekl
    ginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgq
    vlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalq
    ne