PDB entry 1rrc

View 1rrc on RCSB PDB site
Description: t4 polynucleotide kinase bound to 5'-gtc-3' ssDNA
Class: transferase/DNA
Keywords: kinase, phosphatase, alpha/beta, p-loop, ssDNA, transferase-DNA complex
Deposited on 2003-12-08, released 2004-02-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.233
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06855 (0-300)
      • modified residue (0)
      • modified residue (41)
      • modified residue (62)
      • modified residue (138)
      • modified residue (142)
      • modified residue (172)
      • modified residue (191)
      • modified residue (198)
      • modified residue (202)
      • modified residue (226)
      • modified residue (241)
      • modified residue (284)
    Domains in SCOPe 2.02: d1rrca1, d1rrca2
  • Chain 'B':
    Compound: 5'-d(*gp*tp*c)-3'
  • Heterogens: CA, DMS, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rrcA (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrcA (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmdvinpmv
    velskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrk
    ddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'B':
    No sequence available.