PDB entry 1rrb

View 1rrb on RCSB PDB site
Description: the ras-binding domain of raf-1 from rat, nmr, 1 structure
Deposited on 1998-03-26, released 1999-03-30
The last revision prior to the SCOP 1.71 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1rrb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1rrb_ (-)
    asmtggqqmgrgsssktsntirvflpnkqrtvvnvrngmslhdclmkalkvrglqpecca
    vfrllqehkgkkarldwntdaasligeelqvdflklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rrb_ (-)
    ntirvflpnkqrtvvnvrngmslhdclmkalkvrglqpeccavfrllqehkgkkarldwn
    tdaasligeelqvdfl